TXNDC17 (NM_032731) Human Recombinant Protein

Thioredoxin-like 5/TRP14/TXNDC17 protein,

Product Info Summary

SKU: PROTQ9BRA2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TXNDC17 (NM_032731) Human Recombinant Protein

View all Thioredoxin-like 5/TRP14/TXNDC17 recombinant proteins

SKU/Catalog Number

PROTQ9BRA2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human thioredoxin domain containing 17 (TXNDC17)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TXNDC17 (NM_032731) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BRA2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.8 kDa

Amino Acid Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Validation Images & Assay Conditions

Gene/Protein Information For TXNDC17 (Source: Uniprot.org, NCBI)

Gene Name

TXNDC17

Full Name

Thioredoxin domain-containing protein 17

Weight

13.8 kDa

Superfamily

thioredoxin family

Alternative Names

MGC14353; Protein 42-9-9; thioredoxin (Trx)-related protein, 14 kDa; thioredoxin domain containing 17; thioredoxin domain-containing protein 17; Thioredoxin like 5; Thioredoxin-like 5; Thioredoxin-like protein 5; TRP14; TRP1414 kDa thioredoxin-related protein; TXNDC17; TXNL5 Txndc17|4831443O22Rik, D11Ertd672, D11Ertd672e, TRP, TRP14, Txn, Txnl5|thioredoxin domain containing 17|thioredoxin domain-containing protein 17|14 kDa thioredoxin-related protein|protein 42-9-9|putative 42-9-9 protein|thioredoxin-like 5|thioredoxin-like protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TXNDC17, check out the TXNDC17 Infographic

TXNDC17 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TXNDC17: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BRA2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TXNDC17 (NM_032731) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TXNDC17 (NM_032731) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TXNDC17 (NM_032731) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BRA2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.