TTC32 (NM_001008237) Human Recombinant Protein

Ttc32 protein,

Product Info Summary

SKU: PROTQ5I0X7
Size: 20 µg
Source: HEK293T

Product Name

TTC32 (NM_001008237) Human Recombinant Protein

View all Ttc32 recombinant proteins

SKU/Catalog Number

PROTQ5I0X7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tetratricopeptide repeat domain 32 (TTC32)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TTC32 (NM_001008237) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5I0X7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.1 kDa

Amino Acid Sequence

MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNY

Validation Images & Assay Conditions

Gene/Protein Information For Ttc32 (Source: Uniprot.org, NCBI)

Gene Name

Ttc32

Full Name

Tetratricopeptide repeat protein 32

Weight

17.1 kDa

Alternative Names

tetratricopeptide repeat domain 32; tetratricopeptide repeat protein 32; TPR repeat protein 32

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Ttc32, check out the Ttc32 Infographic

Ttc32 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Ttc32: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5I0X7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TTC32 (NM_001008237) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TTC32 (NM_001008237) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TTC32 (NM_001008237) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5I0X7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.