TSPY4 (NM_001164471) Human Recombinant Protein

TSPY4 protein,

Purified recombinant protein of Homo sapiens testis specific protein, Y-linked 4 (TSPY4).

Product Info Summary

SKU: PROTP0CV99
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TSPY4 (NM_001164471) Human Recombinant Protein

View all TSPY4 recombinant proteins

SKU/Catalog Number

PROTP0CV99

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens testis specific protein, Y-linked 4 (TSPY4).

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TSPY4 (NM_001164471) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0CV99)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.5 kDa

Amino Acid Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Validation Images & Assay Conditions

Gene/Protein Information For TSPY4 (Source: Uniprot.org, NCBI)

Gene Name

TSPY4

Full Name

Testis-specific Y-encoded protein 4

Weight

35.5 kDa

Superfamily

nucleosome assembly protein (NAP) family

Alternative Names

Testis Specific Protein, Y-Linked 4; Testis-Specific Y-Encoded Protein 4; TSPY10; TSPY8 TSPY4 TSPY10, TSPY8 testis specific protein Y-linked 4 testis-specific Y-encoded protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TSPY4, check out the TSPY4 Infographic

TSPY4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TSPY4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0CV99

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TSPY4 (NM_001164471) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TSPY4 (NM_001164471) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TSPY4 (NM_001164471) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0CV99
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.