TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein

TSGA2 protein,

Recombinant protein of human radial spoke head 1 homolog (Chlamydomonas) (RSPH1)

Product Info Summary

SKU: PROTQ8WYR4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein

View all TSGA2 recombinant proteins

SKU/Catalog Number

PROTQ8WYR4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human radial spoke head 1 homolog (Chlamydomonas) (RSPH1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WYR4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.9 kDa

Amino Acid Sequence

MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD

Validation Images & Assay Conditions

Gene/Protein Information For RSPH1 (Source: Uniprot.org, NCBI)

Gene Name

RSPH1

Full Name

Radial spoke head 1 homolog

Weight

34.9 kDa

Alternative Names

Cancer/testis antigen 79; CT79; FLJ32753; h-meichroacidin; Male meiotic metaphase chromosome-associated acidic protein; meichroacidin; radial spoke head 1 homolog (Chlamydomonas); radial spoke head 1 homolog; RSP44; RSPH10A; testes specific A2 homolog; testes specific gene A2 homolog; testis specific A2 homolog (mouse); testis specific A2 homolog; Testis-specific gene A2 protein; TSA2MGC126568; TSGA2MGC141927 Rsph1|MC, MCA, Tsg, Tsga2|radial spoke head 1 homolog (Chlamydomonas)|radial spoke head 1 homolog|male meiotic metaphase chromosome-associated acidic protein|meichroacidin|testis-specific gene A2 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RSPH1, check out the RSPH1 Infographic

RSPH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RSPH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WYR4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TSGA2 (RSPH1) (NM_080860) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WYR4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.