TRUB2 (NM_015679) Human Recombinant Protein

TRUB2 protein,

Recombinant protein of human TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2)

Product Info Summary

SKU: PROTO95900
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TRUB2 (NM_015679) Human Recombinant Protein

View all TRUB2 recombinant proteins

SKU/Catalog Number

PROTO95900

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRUB2 (NM_015679) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95900)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.5 kDa

Amino Acid Sequence

MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ

Validation Images & Assay Conditions

Gene/Protein Information For TRUB2 (Source: Uniprot.org, NCBI)

Gene Name

TRUB2

Full Name

Mitochondrial mRNA pseudouridine synthase TRUB2

Weight

36.5 kDa

Superfamily

pseudouridine synthase TruB family

Alternative Names

Mitochondrial mRNA pseudouridine synthase TRUB2 TRUB2 CLONE24922 TruB pseudouridine synthase family member 2 mitochondrial mRNA pseudouridine synthase TRUB2|TruB pseudouridine (psi) synthase family member 2|TruB pseudouridine (psi) synthase homolog 2|probable tRNA pseudouridine synthase 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TRUB2, check out the TRUB2 Infographic

TRUB2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TRUB2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95900

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TRUB2 (NM_015679) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRUB2 (NM_015679) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRUB2 (NM_015679) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95900
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.