TRNT1 (NM_016000) Human Recombinant Protein

TRNT1 protein,

Recombinant protein of human tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1

Product Info Summary

SKU: PROTQ96Q11
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TRNT1 (NM_016000) Human Recombinant Protein

View all TRNT1 recombinant proteins

SKU/Catalog Number

PROTQ96Q11

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tRNA nucleotidyl transferase, CCA-adding, 1 (TRNT1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TRNT1 (NM_016000) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96Q11)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0468kDa

Amino Acid Sequence

MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT

Validation Images & Assay Conditions

Gene/Protein Information For TRNT1 (Source: Uniprot.org, NCBI)

Gene Name

TRNT1

Full Name

CCA tRNA nucleotidyltransferase 1, mitochondrial

Weight

0.0468kDa

Superfamily

tRNA nucleotidyltransferase/poly(A) polymerase family

Alternative Names

CCA1; CCA-adding; CGI-47; EC 2.7.7.72; mitochondrial CCA-adding tRNA-nucleotidyltransferase; mt CCA-adding enzyme; mt tRNA adenylyltransferase; mt tRNA CCA-diphosphorylase; mt tRNA CCA-pyrophosphorylase; MtCCA; tRNA nucleotidyl transferase, CCA-adding, 1; tRNA-nucleotidyltransferase 1, mitochondrial TRNT1 CCA1, CGI-47, MtCCA, RPEM, SIFD tRNA nucleotidyl transferase 1 CCA tRNA nucleotidyltransferase 1, mitochondrial|ATP(CTP):tRNA nucleotidyltransferase|CCA-adding enzyme|mitochondrial CCA-adding tRNA-nucleotidyltransferase|mt CCA-adding enzyme|mt tRNA CCA-diphosphorylase|mt tRNA CCA-pyrophosphorylase|mt tRNA adenylyltransferase|tRNA CCA nucleotidyl transferase 1|tRNA nucleotidyl transferase, CCA-adding, 1|tRNA-nucleotidyltransferase 1, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TRNT1, check out the TRNT1 Infographic

TRNT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TRNT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96Q11

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TRNT1 (NM_016000) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TRNT1 (NM_016000) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TRNT1 (NM_016000) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96Q11
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.