TPRKB (NM_016058) Human Recombinant Protein

TPRKB protein,

Product Info Summary

SKU: PROTQ9Y3C4
Size: 20 µg
Source: HEK293T

Product Name

TPRKB (NM_016058) Human Recombinant Protein

View all TPRKB recombinant proteins

SKU/Catalog Number

PROTQ9Y3C4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TP53RK binding protein (TPRKB)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPRKB (NM_016058) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y3C4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.5 kDa

Amino Acid Sequence

MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

Validation Images & Assay Conditions

Gene/Protein Information For TPRKB (Source: Uniprot.org, NCBI)

Gene Name

TPRKB

Full Name

EKC/KEOPS complex subunit TPRKB

Weight

19.5 kDa

Superfamily

CGI121/TPRKB family

Alternative Names

CGI-121; PRPK (p53-related protein kinase)-binding protein; PRPK-binding protein; TP53RK binding protein; TP53RK-binding protein TPRKB CGI-121, CGI121, GAMOS5 TP53RK binding protein EKC/KEOPS complex subunit TPRKB|PRPK (p53-related protein kinase)-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPRKB, check out the TPRKB Infographic

TPRKB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPRKB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y3C4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TPRKB (NM_016058) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPRKB (NM_016058) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPRKB (NM_016058) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y3C4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.