TPPP3 (NM_015964) Human Recombinant Protein

TPPP3 protein,

Product Info Summary

SKU: PROTQ9BW30
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TPPP3 (NM_015964) Human Recombinant Protein

View all TPPP3 recombinant proteins

SKU/Catalog Number

PROTQ9BW30

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPPP3 (NM_015964) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BW30)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.8 kDa

Amino Acid Sequence

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

Validation Images & Assay Conditions

Gene/Protein Information For TPPP3 (Source: Uniprot.org, NCBI)

Gene Name

TPPP3

Full Name

Tubulin polymerization-promoting protein family member 3

Weight

18.8 kDa

Superfamily

TPPP family

Alternative Names

brain specific protein; CGI-38; p20; p25gamma; TPPP/p20; tubulin polymerization-promoting protein family member 3 TPPP3 CGI-38, TPPP/p20, p20, p25gamma tubulin polymerization promoting protein family member 3 tubulin polymerization-promoting protein family member 3|brain specific protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPPP3, check out the TPPP3 Infographic

TPPP3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPPP3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BW30

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TPPP3 (NM_015964) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPPP3 (NM_015964) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPPP3 (NM_015964) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BW30
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.