TPD52 (NM_005079) Human Recombinant Protein

TPD52 protein,

Recombinant protein of human tumor protein D52 (TPD52), transcript variant 3

Product Info Summary

SKU: PROTP55327
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TPD52 (NM_005079) Human Recombinant Protein

View all TPD52 recombinant proteins

SKU/Catalog Number

PROTP55327

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor protein D52 (TPD52), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TPD52 (NM_005079) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55327)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.7 kDa

Amino Acid Sequence

MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

Validation Images & Assay Conditions

Gene/Protein Information For TPD52 (Source: Uniprot.org, NCBI)

Gene Name

TPD52

Full Name

Tumor protein D52

Weight

19.7 kDa

Superfamily

TPD52 family

Alternative Names

D52; hD52; N8L; PC-1; PrLZ; prostate and colon associated protein; prostate leucine zipper; Protein N8; tumor protein D52 TPD52 D52, N8L, PC-1, PrLZ, hD52 tumor protein D52 tumor protein D52|prostate and colon associated protein|prostate leucine zipper|protein N8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TPD52, check out the TPD52 Infographic

TPD52 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TPD52: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55327

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TPD52 (NM_005079) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TPD52 (NM_005079) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TPD52 (NM_005079) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55327
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.