Click image to see more details
Product Info Summary
| SKU: | PROTQ9R0C2 |
|---|---|
| Size: | 10ug, 50ug, 1mg |
| Origin Species: | Rat |
| Source: | Escherichia coli |
Product info
Product Name
Tpc1808 Tropic 1808 Rat Recombinant Protein
View all TPC1808 recombinant proteins
SKU/Catalog Number
PROTQ9R0C2
Size
10ug, 50ug, 1mg
Description
Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E. coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. The Tpc1808 is purified by proprietary chromatographic techniques.
Storage & Handling
Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles.
Cite This Product
Tpc1808 Tropic 1808 Rat Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9R0C2)
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Purity
Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Amino Acid Sequence
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNF NLYLIKVKNTWKLMTLLLS
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For TPC1808 (Source: Uniprot.org, NCBI)
Gene Name
TPC1808
Full Name
Weight
Alternative Names
Tropic 1808; Tpc1808
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TPC1808, check out the TPC1808 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TPC1808: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Tpc1808 Tropic 1808 Rat Recombinant Protein (PROTQ9R0C2)
Hello CJ!
No publications found for PROTQ9R0C2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Tpc1808 Tropic 1808 Rat Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Tpc1808 Tropic 1808 Rat Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
