TP53TG3 (NM_016212) Human Recombinant Protein

TP53TG3 protein,

Recombinant protein of human TP53 target 3 (TP53TG3)

Product Info Summary

SKU: PROTQ9ULZ0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TP53TG3 (NM_016212) Human Recombinant Protein

View all TP53TG3 recombinant proteins

SKU/Catalog Number

PROTQ9ULZ0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TP53 target 3 (TP53TG3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TP53TG3 (NM_016212) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9ULZ0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.6 kDa

Amino Acid Sequence

MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSG

Validation Images & Assay Conditions

Gene/Protein Information For TP53TG3 (Source: Uniprot.org, NCBI)

Gene Name

TP53TG3

Full Name

TP53-target gene 3 protein

Weight

12.6 kDa

Alternative Names

TP53-target gene 3 protein TP53TG3 P53TG3A, TP53TG3E, TP53TG3F, TP53TG3 TP53 target 3 TP53-target gene 3 protein|TP53-inducible gene 3 protein|p53 target gene 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TP53TG3, check out the TP53TG3 Infographic

TP53TG3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TP53TG3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9ULZ0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TP53TG3 (NM_016212) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TP53TG3 (NM_016212) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TP53TG3 (NM_016212) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9ULZ0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.