TNFAIP8 (NM_014350) Human Recombinant Protein

TNFAIP8 protein,

Product Info Summary

SKU: PROTO95379
Size: 20 µg
Source: HEK293T

Product Name

TNFAIP8 (NM_014350) Human Recombinant Protein

View all TNFAIP8 recombinant proteins

SKU/Catalog Number

PROTO95379

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TNFAIP8 (NM_014350) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95379)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.8 kDa

Amino Acid Sequence

MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Validation Images & Assay Conditions

Gene/Protein Information For TNFAIP8 (Source: Uniprot.org, NCBI)

Gene Name

TNFAIP8

Full Name

Tumor necrosis factor alpha-induced protein 8

Weight

22.8 kDa

Superfamily

TNFAIP8 family

Alternative Names

GG2-1; Head and neck tumor and metastasis-related protein; MDC-3.13TNF-induced protein GG2-1; NDED; NF-kappa-B-inducible DED-containing protein; SCC-S2SCCS2; TNF alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; tumor necrosis factor, alpha-induced protein 8 TNFAIP8 GG2-1, MDC-3.13, NDED, SCC-S2, SCCS2 TNF alpha induced protein 8 tumor necrosis factor alpha-induced protein 8|NF-kappa-B-inducible DED-containing protein|TNF-induced protein GG2-1|head and neck tumor and metastasis-related protein|tumor necrosis factor, alpha induced protein 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFAIP8, check out the TNFAIP8 Infographic

TNFAIP8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFAIP8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TNFAIP8 (NM_014350) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TNFAIP8 (NM_014350) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TNFAIP8 (NM_014350) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95379
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.