TMSB15A (NM_021992) Human Recombinant Protein

NB thymosin beta protein,

Recombinant protein of human thymosin beta 15a (TMSB15A)

Product Info Summary

SKU: PROTP0CG34
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMSB15A (NM_021992) Human Recombinant Protein

View all NB thymosin beta recombinant proteins

SKU/Catalog Number

PROTP0CG34

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human thymosin beta 15a (TMSB15A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMSB15A (NM_021992) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP0CG34)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

5 kDa

Amino Acid Sequence

MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Validation Images & Assay Conditions

Gene/Protein Information For TMSB15A (Source: Uniprot.org, NCBI)

Gene Name

TMSB15A

Full Name

Thymosin beta-15A

Weight

5 kDa

Superfamily

thymosin beta family

Alternative Names

NB thymosin beta; TbNB; thymosin beta 15a; thymosin beta-15A; Thymosin beta-15B; thymosin, beta, identified in neuroblastoma cells; thymosin-like 8; Thymosin-like protein 8; TMSB15; TMSB15B; TMSL8; TMSNBTb15 TMSB15A TMSB15, TMSB15B, TMSL8, TMSNB, Tb15, TbNB thymosin beta 15A thymosin beta-15A|NB thymosin beta|Thymosin beta-15B|thymosin, beta, in neuroblastoma cells|thymosin-like 8|thymosin-like protein 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMSB15A, check out the TMSB15A Infographic

TMSB15A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMSB15A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP0CG34

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMSB15A (NM_021992) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMSB15A (NM_021992) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMSB15A (NM_021992) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP0CG34
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.