TMEM11 (NM_003876) Human Recombinant Protein

TMEM11 protein,

Recombinant protein of human transmembrane protein 11 (TMEM11), transcript variant 1

Product Info Summary

SKU: PROTP17152
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMEM11 (NM_003876) Human Recombinant Protein

View all TMEM11 recombinant proteins

SKU/Catalog Number

PROTP17152

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane protein 11 (TMEM11), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMEM11 (NM_003876) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17152)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV

Validation Images & Assay Conditions

Gene/Protein Information For TMEM11 (Source: Uniprot.org, NCBI)

Gene Name

TMEM11

Full Name

Transmembrane protein 11, mitochondrial

Weight

21.4 kDa

Superfamily

TMEM11 family

Alternative Names

C17orf35; chromosome 17 open reading frame 35; PM1putative receptor protein; PMI; Protein PM1; Protein PMI; transmembrane protein 11 TMEM11 C17orf35, PM1, PMI transmembrane protein 11 transmembrane protein 11, mitochondrial|putative receptor protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMEM11, check out the TMEM11 Infographic

TMEM11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMEM11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP17152

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMEM11 (NM_003876) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMEM11 (NM_003876) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMEM11 (NM_003876) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP17152
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product