TMED6 (NM_144676) Human Recombinant Protein

Tmed6 protein,

Recombinant protein of human transmembrane emp24 protein transport domain containing 6 (TMED6)

Product Info Summary

SKU: PROTQ8WW62
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TMED6 (NM_144676) Human Recombinant Protein

View all Tmed6 recombinant proteins

SKU/Catalog Number

PROTQ8WW62

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane emp24 protein transport domain containing 6 (TMED6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMED6 (NM_144676) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WW62)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.5 kDa

Amino Acid Sequence

MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC

Validation Images & Assay Conditions

Gene/Protein Information For TMED6 (Source: Uniprot.org, NCBI)

Gene Name

TMED6

Full Name

Transmembrane emp24 domain-containing protein 6

Weight

27.5 kDa

Superfamily

EMP24/GP25L family

Alternative Names

MGC23911; PRO34237; SPLL9146; transmembrane emp24 domain-containing protein 6; transmembrane emp24 protein transport domain containing 6

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMED6, check out the TMED6 Infographic

TMED6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMED6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WW62

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMED6 (NM_144676) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMED6 (NM_144676) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMED6 (NM_144676) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WW62
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.