THG1L (NM_017872) Human Recombinant Protein

THG1L protein,

Product Info Summary

SKU: PROTQ9NWX6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

THG1L (NM_017872) Human Recombinant Protein

View all THG1L recombinant proteins

SKU/Catalog Number

PROTQ9NWX6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) (THG1L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

THG1L (NM_017872) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NWX6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.7 kDa

Amino Acid Sequence

MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS

Validation Images & Assay Conditions

Gene/Protein Information For THG1L (Source: Uniprot.org, NCBI)

Gene Name

THG1L

Full Name

Probable tRNA(His) guanylyltransferase

Weight

34.7 kDa

Superfamily

tRNA(His) guanylyltransferase family

Alternative Names

EC 2.7.7; EC 2.7.7.6; FLJ11601; FLJ20546; ICF45EC 2.7.7.-; Interphase cytoplasmic foci protein 45; probable tRNA(His) guanylyltransferase; tRNA-histidine guanylyltransferase 1-like (S. cerevisiae); tRNA-histidine guanylyltransferase THG1L ICF45, IHG-1, IHG1, SCAR28, THG1, hTHG1 tRNA-histidine guanylyltransferase 1 like probable tRNA(His) guanylyltransferase|induced by high glucose-1|induced in high glucose-1|interphase cytoplasmic foci protein 45

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on THG1L, check out the THG1L Infographic

THG1L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for THG1L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used THG1L (NM_017872) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For THG1L (NM_017872) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for THG1L (NM_017872) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NWX6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.