THAP1 (NM_018105) Human Recombinant Protein

THAP1 protein,

Product Info Summary

SKU: PROTQ9NVV9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

THAP1 (NM_018105) Human Recombinant Protein

View all THAP1 recombinant proteins

SKU/Catalog Number

PROTQ9NVV9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human THAP domain containing, apoptosis associated protein 1 (THAP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

THAP1 (NM_018105) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NVV9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.8 kDa

Amino Acid Sequence

MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

Validation Images & Assay Conditions

Gene/Protein Information For THAP1 (Source: Uniprot.org, NCBI)

Gene Name

THAP1

Full Name

THAP domain-containing protein 1

Weight

24.8 kDa

Superfamily

THAP1 family

Alternative Names

4833431A01Rik; dystonia 6, torsion (autosomal dominant); DYT6; FLJ10477; MGC33014; nuclear proapoptotic factor; THAP domain containing, apoptosis associated protein 1; THAP domain protein 1; THAP domain-containing protein 1 THAP1 DYT6 THAP domain containing 1 THAP domain-containing protein 1|4833431A01Rik|THAP domain containing, apoptosis associated protein 1|THAP domain protein 1|nuclear proapoptotic factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on THAP1, check out the THAP1 Infographic

THAP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for THAP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NVV9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used THAP1 (NM_018105) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For THAP1 (NM_018105) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for THAP1 (NM_018105) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NVV9
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.