TGIF2LY (NM_139214) Human Recombinant Protein

TGIF2LY protein,

Product Info Summary

SKU: PROTQ8IUE0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TGIF2LY (NM_139214) Human Recombinant Protein

View all TGIF2LY recombinant proteins

SKU/Catalog Number

PROTQ8IUE0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TGFB-induced factor homeobox 2-like, Y-linked (TGIF2LY)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TGIF2LY (NM_139214) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IUE0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.6 kDa

Amino Acid Sequence

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE

Validation Images & Assay Conditions

Gene/Protein Information For TGIF2LY (Source: Uniprot.org, NCBI)

Gene Name

TGIF2LY

Full Name

Homeobox protein TGIF2LY

Weight

20.6 kDa

Superfamily

TALE/TGIF homeobox family

Alternative Names

Homeobox protein TGIF2LY TGIF2LY TGIFLY TGFB induced factor homeobox 2 like Y-linked homeobox protein TGIF2LY|TGF-beta-induced transcription factor 2-like protein|TGFB-induced factor 2-like protein, Y-linked|TGFB-induced factor 2-like, Y-linked|TGIF-like on the Y

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TGIF2LY, check out the TGIF2LY Infographic

TGIF2LY infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TGIF2LY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used TGIF2LY (NM_139214) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TGIF2LY (NM_139214) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TGIF2LY (NM_139214) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IUE0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.