TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

TGF beta induced factor 2 protein,

Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2)

Product Info Summary

SKU: PROTQ9GZN2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

View all TGF beta induced factor 2 recombinant proteins

SKU/Catalog Number

PROTQ9GZN2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TGFB-induced factor homeobox 2 (TGIF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZN2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.7 kDa

Amino Acid Sequence

MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ

Validation Images & Assay Conditions

Gene/Protein Information For TGIF2 (Source: Uniprot.org, NCBI)

Gene Name

TGIF2

Full Name

Homeobox protein TGIF2

Weight

25.7 kDa

Superfamily

TALE/TGIF homeobox family

Alternative Names

homeobox protein TGIF2; TGF(beta)-induced transcription factor 2; TGF-beta-induced transcription factor 2,5'-TG-3'-interacting factor 2,5'-TG-3' interacting factor 2; TGFB-induced factor 2 (TALE family homeobox); TGFB-induced factor 2; TGFB-induced factor homeobox 2; transcription growth factor-beta-induced factor 2 TGIF2 TGFB induced factor homeobox 2 homeobox protein TGIF2|5-TG-3 interacting factor 2|TGF(beta)-induced transcription factor 2|TGFB-induced factor 2 (TALE family homeobox)|transcription growth factor-beta-induced factor 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TGIF2, check out the TGIF2 Infographic

TGIF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TGIF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZN2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TGF beta induced factor 2 (TGIF2) (NM_021809) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZN2
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.