Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein

TCL1A protein,

Product Info Summary

SKU: PROTP56279
Size: 20 µg
Source: HEK293T

Product Name

Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein

View all TCL1A recombinant proteins

SKU/Catalog Number

PROTP56279

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human T-cell leukemia/lymphoma 1A (TCL1A), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56279)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.3 kDa

Amino Acid Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Validation Images & Assay Conditions

Gene/Protein Information For TCL1A (Source: Uniprot.org, NCBI)

Gene Name

TCL1A

Full Name

T-cell leukemia/lymphoma protein 1A

Weight

13.3 kDa

Superfamily

TCL1 family

Alternative Names

Oncogene TCL1; Oncogene TCL-1; Protein p14 TCL1; T-cell leukemia/lymphoma 1A; T-cell lymphoma-1; T-cell lymphoma-1A; TCL1A; TCL1-PEN; TCL1T-cell leukemia/lymphoma protein 1A TCL1A TCL1 TCL1 family AKT coactivator A T-cell leukemia/lymphoma protein 1A|T cell leukemia/lymphoma 1A|T-cell lymphoma-1|oncogene TCL-1|oncogene TCL1|protein p14 TCL1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TCL1A, check out the TCL1A Infographic

TCL1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TCL1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56279

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Tcl1 (TCL1A) (NM_021966) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56279
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.