TBCA (NM_004607) Human Recombinant Protein

TBCA protein,

Product Info Summary

SKU: PROTO75347
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TBCA (NM_004607) Human Recombinant Protein

View all TBCA recombinant proteins

SKU/Catalog Number

PROTO75347

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tubulin folding cofactor A (TBCA)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TBCA (NM_004607) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO75347)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.7 kDa

Amino Acid Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Validation Images & Assay Conditions

Gene/Protein Information For TBCA (Source: Uniprot.org, NCBI)

Gene Name

TBCA

Full Name

Tubulin-specific chaperone A

Weight

12.7 kDa

Superfamily

TBCA family

Alternative Names

CFA; chaperonin cofactor A; TCP1-chaperonin cofactor A; tubulin folding cofactor A; Tubulin-folding cofactor A; tubulin-specific chaperone a TBCA tubulin folding cofactor A tubulin-specific chaperone A|CFA|TCP1-chaperonin cofactor A|chaperonin cofactor A|epididymis secretory sperm binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TBCA, check out the TBCA Infographic

TBCA infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TBCA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO75347

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TBCA (NM_004607) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TBCA (NM_004607) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TBCA (NM_004607) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO75347
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.