TAF7 (NM_005642) Human Recombinant Protein

TAF7 protein,

Recombinant protein of human TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7)

Product Info Summary

SKU: PROTQ15545
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TAF7 (NM_005642) Human Recombinant Protein

View all TAF7 recombinant proteins

SKU/Catalog Number

PROTQ15545

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa (TAF7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TAF7 (NM_005642) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ15545)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.1 kDa

Amino Acid Sequence

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Validation Images & Assay Conditions

Gene/Protein Information For TAF7 (Source: Uniprot.org, NCBI)

Gene Name

TAF7

Full Name

Transcription initiation factor TFIID subunit 7

Weight

40.1 kDa

Superfamily

TAF7 family

Alternative Names

TAF(II)55; TAF2FTBP-associated factor F; TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; TAFII-55; TAFII55RNA polymerase II TBP-associated factor subunit F; TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD; transcription factor IID subunit TAFII55; Transcription initiation factor TFIID 55 kDa subunit; transcription initiation factor TFIID subunit 7; transcription initiation factor TFIID, 55 kDa subunit TAF7 TAF2F, TAFII55 TATA-box binding protein associated factor 7 transcription initiation factor TFIID subunit 7|RNA polymerase II TBP-associated factor subunit F|TAF(II)55|TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa|TAFII-55|TATA box binding protein (TBP)-associated factor, RNA polymerase II, F, 55kD|TBP-associated factor F|transcription factor IID subunit TAFII55|transcription initiation factor TFIID, 55 kDa subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TAF7, check out the TAF7 Infographic

TAF7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TAF7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ15545

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TAF7 (NM_005642) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TAF7 (NM_005642) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TAF7 (NM_005642) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ15545
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.