TAF12 (NM_005644) Human Recombinant Protein

TAF12 protein,

Recombinant protein of human TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa (TAF12), transcript variant 2

Product Info Summary

SKU: PROTQ16514
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

TAF12 (NM_005644) Human Recombinant Protein

View all TAF12 recombinant proteins

SKU/Catalog Number

PROTQ16514

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa (TAF12), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TAF12 (NM_005644) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16514)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.7 kDa

Amino Acid Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Validation Images & Assay Conditions

Gene/Protein Information For TAF12 (Source: Uniprot.org, NCBI)

Gene Name

TAF12

Full Name

Transcription initiation factor TFIID subunit 12

Weight

17.7 kDa

Superfamily

TAF12 family

Alternative Names

20kDa; TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF15; TAF2J; TAFII-20/TAFII-15; TAFII20TAFII20/TAFII15; TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD; Transcription initiation factor TFIID 20/15 kDa subunits; transcription initiation factor TFIID subunit 12 TAF12 TAF2J, TAFII20 TATA-box binding protein associated factor 12 transcription initiation factor TFIID subunit 12|TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa|TAFII-20/TAFII-15|TAFII20/TAFII15|TATA box binding protein (TBP)-associated factor, RNA polymerase II, J, 20kD|transcription initiation factor TFIID 20/15 kDa subunits

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TAF12, check out the TAF12 Infographic

TAF12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TAF12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16514

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TAF12 (NM_005644) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TAF12 (NM_005644) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TAF12 (NM_005644) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16514
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.