SYS1 (NM_033542) Human Recombinant Protein

Sys1 protein,

Recombinant protein of human SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1

Product Info Summary

SKU: PROTQ8N2H4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SYS1 (NM_033542) Human Recombinant Protein

View all Sys1 recombinant proteins

SKU/Catalog Number

PROTQ8N2H4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae) (SYS1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SYS1 (NM_033542) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N2H4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.4 kDa

Amino Acid Sequence

MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWFYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLNSAPKSNV

Validation Images & Assay Conditions

Gene/Protein Information For SYS1 (Source: Uniprot.org, NCBI)

Gene Name

SYS1

Full Name

Protein SYS1 homolog

Weight

17.4 kDa

Superfamily

SYS1 family

Alternative Names

C20orf169; chromosome 20 open reading frame 169; dJ453C12.4; dJ453C12.4.1; protein SYS1 homolog; SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SYS1, check out the SYS1 Infographic

SYS1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SYS1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N2H4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SYS1 (NM_033542) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SYS1 (NM_033542) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SYS1 (NM_033542) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N2H4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.