Click image to see more details
Product Info Summary
| SKU: | PROTP23563-1 |
|---|---|
| Size: | 5ug,20ug |
| Origin Species: | Swine |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
View all TNF-alpha recombinant proteins
SKU/Catalog Number
PROTP23563-1
Size
5ug,20ug
Tag
His Tag (C-term)
Description
Tumor necrosis factor alpha (TNF alpha) stimulates the acute phase of the immune response. In response to a pathogen, TNF alpha is one of the first to be released and can apply its effects in many organs. TNF alpha stimulates the release of corticotropic releasing hormone, suppresses appetite, and induces fever, in the hypothalamus. TNF increase vasodilation and loss of vascular permeability, it helps recruit lymphocyte, neutrophil, and monocyte to the inflammation site by regulating chemokine release.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP23563-1)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
25.644kDa
Molecular weight
The protein has a calculated MW of 18.1 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED₅₀ for this effect is <15 pg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine TNF alpha
Protein Target Info & Infographic
Gene/Protein Information For TNF (Source: Uniprot.org, NCBI)
Gene Name
TNF
Full Name
Tumor necrosis factor
Weight
25.644kDa
Superfamily
Tumor necrosis factor family
Alternative Names
TNFa, TNFSF2 TNF DIF-alpha, TNFA, TNFSF2, TNLG1F, TNF tumor necrosis factor tumor necrosis factor|APC1 protein|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|tumor necrosis factor ligand 1F|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNF, check out the TNF Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF (PROTP23563-1)
Hello CJ!
No publications found for PROTP23563-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant TNF alpha (Tumor necrosis factor alpha) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
