Click image to see more details
Product Info Summary
| SKU: | PROTP17803 |
|---|---|
| Size: | 5ug,20ug |
| Origin Species: | Swine |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant IFN gamma (Interferon gamma) protein, AF
View all IFN-gamma recombinant proteins
SKU/Catalog Number
PROTP17803
Size
5ug,20ug
Tag
His Tag (C-term)
Description
The cytokine IFN gamma could protect cells from viral infections and belongs to the family of interferons. A lot of studies have shown that IFN gamma secreted by antigen triggered cell types, including T cells, naive CD4+ T cells, macrophages, dendritic cells, and B cells. IFN gamma plays an important role to trigger the macrophage act against a diverse group of microbial targets, and the pleiotropic molecule associated with antiproliferative, pro-apoptotic and antitumor mechanisms. Based on the effector cytokine considered as a major effector of immunity, it has been used in the treatment of several diseases.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant IFN gamma (Interferon gamma) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP17803)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
19.348kDa
Molecular weight
The protein has a calculated MW of 17.7 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <40 pg/mL.
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine IFN gamma
Protein Target Info & Infographic
Gene/Protein Information For IFNG (Source: Uniprot.org, NCBI)
Gene Name
IFNG
Full Name
Interferon gamma
Weight
19.348kDa
Superfamily
type II (or gamma) interferon family
Alternative Names
IFNG IFNG IFG, IFI, IMD69 interferon gamma interferon gamma|IFN-gamma|immune interferon
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IFNG, check out the IFNG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant IFN gamma (Interferon gamma) protein, AF (PROTP17803)
Hello CJ!
No publications found for PROTP17803
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant IFN gamma (Interferon gamma) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant IFN gamma (Interferon gamma) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
