Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

CXCL11/I-TAC protein, Swine

C-X-C motif chemokine 11 (CXCL11) also named Interferon-gamma-inducible protein 9 (IP-9), which is a chemokine of the intercrine alpha family. CXCL11 is a 8.8kDa protein containing 79 amino acid residues. To CXCR3, CXCL11 has higher affinity than CXCL10 and CXCL9 which plays a role in immune activation. CXCL11 induces the activation of T cells which is also a chemotaxis for T cells. CXCL11 is produced in response for IFN Family.

Product Info Summary

SKU: PROTA0A4X1SX03
Size: 5ug,20ug
Origin Species: Swine
Source: Escherichia coli
Application: Cell Culture

Product Name

Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

View all CXCL11/I-TAC recombinant proteins

SKU/Catalog Number

PROTA0A4X1SX03

Size

5ug,20ug

Tag

His Tag (N-term)

Description

C-X-C motif chemokine 11 (CXCL11) also named Interferon-gamma-inducible protein 9 (IP-9), which is a chemokine of the intercrine alpha family. CXCL11 is a 8.8kDa protein containing 79 amino acid residues. To CXCR3, CXCL11 has higher affinity than CXCL10 and CXCL9 which plays a role in immune activation. CXCL11 induces the activation of T cells which is also a chemotaxis for T cells. CXCL11 is produced in response for IFN Family.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A4X1SX03)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

10.365kDa

Molecular weight

The protein has a calculated MW of 9.72 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).

Activity

Testing in process

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For CXCL11 (Source: Uniprot.org, NCBI)

Gene Name

CXCL11

Full Name

C-X-C motif chemokine 11

Weight

10.365kDa

Superfamily

intercrine alpha (chemokine CxC) family

Alternative Names

beta-R1; b-R1; chemokine (C-X-C motif) ligand 11; CXCL11; H174; H174IP9; Interferon gamma-inducible protein 9; Interferon-inducible T-cell alpha chemoattractant; IP-9member 11; ITAC; I-TAC; I-TACMGC102770; SCYB9B; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; Small-inducible cytokine B11 CXCL11 H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1 C-X-C motif chemokine ligand 11 C-X-C motif chemokine 11|beta-R1|chemokine (C-X-C motif) ligand 11|interferon gamma-inducible protein 9|interferon-inducible T-cell alpha chemoattractant|small inducible cytokine B11|small inducible cytokine subfamily B (Cys-X-Cys), member 11|small inducible cytokine subfamily B (Cys-X-Cys), member 9B

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CXCL11, check out the CXCL11 Infographic

CXCL11 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CXCL11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF

Size

Total: $154

SKU:PROTA0A4X1SX03

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTA0A4X1SX03
$154.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.