Product Info Summary
SKU: | PROTA0A4X1SX03 |
---|---|
Size: | 5ug,20ug |
Origin Species: | Swine |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF
View all CXCL11/I-TAC recombinant proteins
SKU/Catalog Number
PROTA0A4X1SX03
Size
5ug,20ug
Tag
His Tag (N-term)
Description
C-X-C motif chemokine 11 (CXCL11) also named Interferon-gamma-inducible protein 9 (IP-9), which is a chemokine of the intercrine alpha family. CXCL11 is a 8.8kDa protein containing 79 amino acid residues. To CXCR3, CXCL11 has higher affinity than CXCL10 and CXCL9 which plays a role in immune activation. CXCL11 induces the activation of T cells which is also a chemotaxis for T cells. CXCL11 is produced in response for IFN Family.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A4X1SX03)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
10.365kDa
Molecular weight
The protein has a calculated MW of 9.72 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant swine CXCL11
Protein Target Info & Infographic
Gene/Protein Information For CXCL11 (Source: Uniprot.org, NCBI)
Gene Name
CXCL11
Full Name
C-X-C motif chemokine 11
Weight
10.365kDa
Superfamily
intercrine alpha (chemokine CxC) family
Alternative Names
beta-R1; b-R1; chemokine (C-X-C motif) ligand 11; CXCL11; H174; H174IP9; Interferon gamma-inducible protein 9; Interferon-inducible T-cell alpha chemoattractant; IP-9member 11; ITAC; I-TAC; I-TACMGC102770; SCYB9B; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; Small-inducible cytokine B11 CXCL11 H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1 C-X-C motif chemokine ligand 11 C-X-C motif chemokine 11|beta-R1|chemokine (C-X-C motif) ligand 11|interferon gamma-inducible protein 9|interferon-inducible T-cell alpha chemoattractant|small inducible cytokine B11|small inducible cytokine subfamily B (Cys-X-Cys), member 11|small inducible cytokine subfamily B (Cys-X-Cys), member 9B
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CXCL11, check out the CXCL11 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CXCL11: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF (PROTA0A4X1SX03)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Swine recombinant CXCL11 (C-X-C motif chemokine 11) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question