STK38L (NM_015000) Human Recombinant Protein

STK38L protein,

Recombinant protein of human serine/threonine kinase 38 like (STK38L)

Product Info Summary

SKU: PROTQ9Y2H1
Size: 20 µg
Source: HEK293T

Product Name

STK38L (NM_015000) Human Recombinant Protein

View all STK38L recombinant proteins

SKU/Catalog Number

PROTQ9Y2H1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serine/threonine kinase 38 like (STK38L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

STK38L (NM_015000) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y2H1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

53.8 kDa

Amino Acid Sequence

MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL

Validation Images & Assay Conditions

Gene/Protein Information For STK38L (Source: Uniprot.org, NCBI)

Gene Name

STK38L

Full Name

Serine/threonine-protein kinase 38-like

Weight

53.8 kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.1; KIAA0965nuclear Dbf2-related 2; NDR2 protein kinase; NDR2serine/threonine-protein kinase 38-like; Nuclear Dbf2-related kinase 2; serine/threonine kinase 38 like STK38L NDR2 serine/threonine kinase 38 like serine/threonine-protein kinase 38-like|NDR2 protein kinase|nuclear Dbf2-related 2|nuclear Dbf2-related kinase 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STK38L, check out the STK38L Infographic

STK38L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STK38L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used STK38L (NM_015000) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For STK38L (NM_015000) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for STK38L (NM_015000) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y2H1
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.