STARD4 (NM_139164) Human Recombinant Protein

STARD4 protein,

Recombinant protein of human StAR-related lipid transfer (START) domain containing 4 (STARD4)

Product Info Summary

SKU: PROTQ96DR4
Size: 20 µg
Source: HEK293T

Product Name

STARD4 (NM_139164) Human Recombinant Protein

View all STARD4 recombinant proteins

SKU/Catalog Number

PROTQ96DR4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human StAR-related lipid transfer (START) domain containing 4 (STARD4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

STARD4 (NM_139164) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96DR4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.3 kDa

Amino Acid Sequence

MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Validation Images & Assay Conditions

Gene/Protein Information For STARD4 (Source: Uniprot.org, NCBI)

Gene Name

STARD4

Full Name

StAR-related lipid transfer protein 4

Weight

23.3 kDa

Alternative Names

StARD4; StAR-related lipid transfer (START) domain containing 4; stAR-related lipid transfer protein 4; START domain containing 4 sterol-regulated; START domain-containing protein 4; sterol regulated STARD4 StAR related lipid transfer domain containing 4 stAR-related lipid transfer protein 4|START domain containing 4, sterol regulated|START domain-containing protein 4|StAR-related lipid transfer (START) domain containing 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on STARD4, check out the STARD4 Infographic

STARD4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STARD4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96DR4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used STARD4 (NM_139164) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For STARD4 (NM_139164) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for STARD4 (NM_139164) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96DR4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.