SSR3 (NM_007107) Human Recombinant Protein

SSR3 protein,

Recombinant protein of human signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3)

Product Info Summary

SKU: PROTQ9UNL2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SSR3 (NM_007107) Human Recombinant Protein

View all SSR3 recombinant proteins

SKU/Catalog Number

PROTQ9UNL2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human signal sequence receptor, gamma (translocon-associated protein gamma) (SSR3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SSR3 (NM_007107) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UNL2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.9 kDa

Amino Acid Sequence

MAPKGSSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFFILKNFNPTVNYILSISASSGLIALLSTGSK

Validation Images & Assay Conditions

Gene/Protein Information For SSR3 (Source: Uniprot.org, NCBI)

Gene Name

SSR3

Full Name

Translocon-associated protein subunit gamma

Weight

20.9 kDa

Superfamily

TRAP-gamma family

Alternative Names

signal sequence receptor, gamma (translocon-associated protein gamma); SSR gamma; SSR-gamma; translocon-associated protein gamma subunit; translocon-associated protein subunit gamma; TRAP-complex gamma subunit; TRAP-gamma; TRAPGSignal sequence receptor subunit gamma SSR3 TRAPG signal sequence receptor subunit 3 translocon-associated protein subunit gamma|SSR gamma|TRAP-complex gamma subunit|TRAP-gamma|signal sequence receptor subunit gamma|signal sequence receptor, gamma (translocon-associated protein gamma)|translocon-associated protein gamma subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SSR3, check out the SSR3 Infographic

SSR3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SSR3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UNL2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SSR3 (NM_007107) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SSR3 (NM_007107) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SSR3 (NM_007107) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UNL2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.