SPSB1 (NM_025106) Human Recombinant Protein

Spsb1 protein,

Product Info Summary

SKU: PROTQ96BD6
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPSB1 (NM_025106) Human Recombinant Protein

View all Spsb1 recombinant proteins

SKU/Catalog Number

PROTQ96BD6

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPSB1 (NM_025106) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96BD6)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.8 kDa

Amino Acid Sequence

MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ

Validation Images & Assay Conditions

Gene/Protein Information For SPSB1 (Source: Uniprot.org, NCBI)

Gene Name

SPSB1

Full Name

SPRY domain-containing SOCS box protein 1

Weight

30.8 kDa

Superfamily

SPSB family

Alternative Names

novel SPRY domain containing protein; splA/ryanodine receptor domain and SOCS box containing 1; SPRY domain-containing SOCS box protein 1; SSB-1SPRY domain-containing SOCS box protein SSB-1; SSB1SPSB Spsb1|1110014L01Rik, 4930422J18Rik, AI596360, AI854583, SS, SSB-1, SSB1|splA/ryanodine receptor domain and SOCS box containing 1|SPRY domain-containing SOCS box protein 1|SPRY domain-containing SOCS box protein SSB-1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPSB1, check out the SPSB1 Infographic

SPSB1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPSB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96BD6

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPSB1 (NM_025106) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPSB1 (NM_025106) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPSB1 (NM_025106) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96BD6
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.