SPINK7 (NM_032566) Human Recombinant Protein

SPINK7 protein,

Product Info Summary

SKU: PROTP58062
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPINK7 (NM_032566) Human Recombinant Protein

View all SPINK7 recombinant proteins

SKU/Catalog Number

PROTP58062

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serine peptidase inhibitor, Kazal type 7 (putative) (SPINK7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPINK7 (NM_032566) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP58062)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.1 kDa

Amino Acid Sequence

MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC

Validation Images & Assay Conditions

Gene/Protein Information For SPINK7 (Source: Uniprot.org, NCBI)

Gene Name

SPINK7

Full Name

Serine protease inhibitor Kazal-type 7

Weight

9.1 kDa

Alternative Names

Serine protease inhibitor Kazal-type 7 SPINK7 ECG2, ECRG2 serine peptidase inhibitor Kazal type 7 serine protease inhibitor Kazal-type 7|ECRG-2|esophagus cancer-related gene 2 protein|esophagus cancer-related gene-2|serine peptidase inhibitor, Kazal type 7 (putative)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPINK7, check out the SPINK7 Infographic

SPINK7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPINK7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP58062

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPINK7 (NM_032566) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPINK7 (NM_032566) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPINK7 (NM_032566) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP58062
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.