SPDEF (NM_012391) Human Recombinant Protein

SPDEF protein,

Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF)

Product Info Summary

SKU: PROTO95238
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPDEF (NM_012391) Human Recombinant Protein

View all SPDEF recombinant proteins

SKU/Catalog Number

PROTO95238

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SAM pointed domain containing ets transcription factor (SPDEF)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPDEF (NM_012391) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95238)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.3 kDa

Amino Acid Sequence

MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI

Validation Images & Assay Conditions

Gene/Protein Information For SPDEF (Source: Uniprot.org, NCBI)

Gene Name

SPDEF

Full Name

SAM pointed domain-containing Ets transcription factor

Weight

37.3 kDa

Superfamily

ETS family

Alternative Names

bA375E1.3; PDEFRP11-375E1__A.3; Prostate epithelium-specific Ets transcription factor; Prostate-derived Ets factor; Prostate-specific Ets; PSE; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor SPDEF PDEF, bA375E1.3 SAM pointed domain containing ETS transcription factor SAM pointed domain-containing Ets transcription factor|prostate epithelium-specific Ets transcription factor|prostate-derived Ets factor|prostate-specific Ets

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPDEF, check out the SPDEF Infographic

SPDEF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPDEF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95238

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPDEF (NM_012391) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPDEF (NM_012391) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPDEF (NM_012391) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95238
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.