SPAG11B (NM_058201) Human Recombinant Protein

SPAG11B protein,

Recombinant protein of human sperm associated antigen 11B (SPAG11B), transcript variant D

Product Info Summary

SKU: PROTQ08648
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPAG11B (NM_058201) Human Recombinant Protein

View all SPAG11B recombinant proteins

SKU/Catalog Number

PROTQ08648

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sperm associated antigen 11B (SPAG11B), transcript variant D

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SPAG11B (NM_058201) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ08648)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGDVPPGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI

Validation Images & Assay Conditions

Gene/Protein Information For SPAG11B (Source: Uniprot.org, NCBI)

Gene Name

SPAG11B

Full Name

Sperm-associated antigen 11B

Weight

12.1 kDa

Superfamily

SPAG11 family

Alternative Names

EP2; sperm associated antigen 11B SPAG11B EDDM2B, EP2, EP2C, EP2D, HE2, HE2C, SPAG11, SPAG11A sperm associated antigen 11B sperm-associated antigen 11B|Protein EP2|Sperm-associated antigen 11A|epididymal protein 2B|human epididymis-specific protein 2|sperm antigen HE2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SPAG11B, check out the SPAG11B Infographic

SPAG11B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SPAG11B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ08648

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPAG11B (NM_058201) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPAG11B (NM_058201) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPAG11B (NM_058201) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ08648
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.