SP5 (NM_001003845) Human Recombinant Protein

Sp5 protein,

Recombinant protein of human Sp5 transcription factor (SP5)

Product Info Summary

SKU: PROTQ6BEB4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SP5 (NM_001003845) Human Recombinant Protein

View all Sp5 recombinant proteins

SKU/Catalog Number

PROTQ6BEB4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Sp5 transcription factor (SP5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SP5 (NM_001003845) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6BEB4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

41.8 kDa

Amino Acid Sequence

MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL

Validation Images & Assay Conditions

Gene/Protein Information For SP5 (Source: Uniprot.org, NCBI)

Gene Name

SP5

Full Name

Transcription factor Sp5

Weight

41.8 kDa

Superfamily

Sp1 C2H2-type zinc-finger protein family

Alternative Names

Transcription factor Sp5 Sp5|trans-acting transcription factor 5|transcription factor Sp5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SP5, check out the SP5 Infographic

SP5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SP5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6BEB4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SP5 (NM_001003845) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SP5 (NM_001003845) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SP5 (NM_001003845) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6BEB4
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.