SNX21 (NM_152897) Human Recombinant Protein

SNX21 protein,

Recombinant protein of human sorting nexin family member 21 (SNX21), transcript variant 2

Product Info Summary

SKU: PROTQ969T3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNX21 (NM_152897) Human Recombinant Protein

View all SNX21 recombinant proteins

SKU/Catalog Number

PROTQ969T3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human sorting nexin family member 21 (SNX21), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNX21 (NM_152897) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ969T3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.7 kDa

Amino Acid Sequence

MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDEDDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANVVKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH

Validation Images & Assay Conditions

Gene/Protein Information For SNX21 (Source: Uniprot.org, NCBI)

Gene Name

SNX21

Full Name

Sorting nexin-21

Weight

21.7 kDa

Superfamily

sorting nexin family

Alternative Names

C20orf161; chromosome 20 open reading frame 161; MGC29895; PP3993; SNXL; SNX-LdJ337O18.4; sorting nexin 21; sorting nexin family member 21; Sorting nexin L; sorting nexin-21 SNX21 C20orf161, PP3993, SNX-L, SNXL, dJ337O18.4 sorting nexin family member 21 sorting nexin-21|sorting nexin L

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNX21, check out the SNX21 Infographic

SNX21 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNX21: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ969T3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNX21 (NM_152897) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNX21 (NM_152897) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNX21 (NM_152897) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ969T3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.