SNAPIN (NM_012437) Human Recombinant Protein

Snapin protein,

Product Info Summary

SKU: PROTO95295
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SNAPIN (NM_012437) Human Recombinant Protein

View all Snapin recombinant proteins

SKU/Catalog Number

PROTO95295

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SNAP-associated protein (SNAPIN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SNAPIN (NM_012437) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95295)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.7 kDa

Amino Acid Sequence

MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

Validation Images & Assay Conditions

Gene/Protein Information For SNAPIN (Source: Uniprot.org, NCBI)

Gene Name

SNAPIN

Full Name

SNARE-associated protein Snapin

Weight

14.7 kDa

Superfamily

SNAPIN family

Alternative Names

SNAP-25-binding protein; SNAP25BP; SNAPAP; SNAPAPSNARE-associated protein Snapin; SNAP-associated proteinSNARE associated protein snapin; Snapin; Synaptosomal-associated protein 25-binding protein Snapin|25kDa, AA407989, AV026596, Bloc, Bloc1s7, Sna, Snap25bp, Snapap|SNAP-associated protein|SNARE-associated protein Snapin|BLOC-1 subunit 7|biogenesis of lysosome-related organelles complex 1 subunit 7|synaptosomal-associated protein 25 binding protein|synaptosomal-associated protein, 25 kDa, binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SNAPIN, check out the SNAPIN Infographic

SNAPIN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SNAPIN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95295

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SNAPIN (NM_012437) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SNAPIN (NM_012437) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SNAPIN (NM_012437) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95295
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.