SMAD9 (NM_005905) Human Recombinant Protein

Smad9 protein,

Recombinant protein of human SMAD family member 9 (SMAD9), transcript variant b

Product Info Summary

SKU: PROTO15198
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SMAD9 (NM_005905) Human Recombinant Protein

View all Smad9 recombinant proteins

SKU/Catalog Number

PROTO15198

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SMAD family member 9 (SMAD9), transcript variant b

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SMAD9 (NM_005905) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15198)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.5 kDa

Amino Acid Sequence

MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Validation Images & Assay Conditions

Gene/Protein Information For SMAD9 (Source: Uniprot.org, NCBI)

Gene Name

SMAD9

Full Name

Mothers against decapentaplegic homolog 9

Weight

48.5 kDa

Superfamily

dwarfin/SMAD family

Alternative Names

MAD homolog 9; MAD, mothers against decapentaplegic homolog 9 (Drosophila); Madh6; MADH6mothers against decapentaplegic homolog 9; MADH9; MADH9Mothers against decapentaplegic, drosophila, homolog of, 9; Mothers against DPP homolog 9; SMAD 9; SMAD family member 9SMAD8B; SMAD, mothers against DPP homolog 9 (Drosophila); SMAD, mothers against DPP homolog 9; SMAD8; SMAD8A; Smad9 SMAD9 MADH6, MADH9, PPH2, SMAD8, SMAD8/9, SMAD8A, SMAD8B SMAD family member 9 mothers against decapentaplegic homolog 9|MAD homolog 9|Mothers against decapentaplegic, drosophila, homolog of, 9|SMAD, mothers against DPP homolog 9

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SMAD9, check out the SMAD9 Infographic

SMAD9 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMAD9: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15198

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SMAD9 (NM_005905) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SMAD9 (NM_005905) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SMAD9 (NM_005905) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15198
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.