SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein

Transgelin/TAGLN/SM22 alpha protein,

Product Info Summary

SKU: PROTQ01995
Size: 20 µg
Source: HEK293T

Product Name

SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein

View all Transgelin/TAGLN/SM22 alpha recombinant proteins

SKU/Catalog Number

PROTQ01995

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transgelin (TAGLN), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ01995)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.4 kDa

Amino Acid Sequence

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Validation Images & Assay Conditions

Gene/Protein Information For TAGLN (Source: Uniprot.org, NCBI)

Gene Name

TAGLN

Full Name

Transgelin

Weight

22.4 kDa

Superfamily

calponin family

Alternative Names

DKFZp686P11128; Protein WS3-10; SM22 alpha; SM2222 kDa actin-binding protein; SMCCDKFZp686B01212; Smooth muscle protein 22-alpha; TAGLN; TAGLN1; transgelin variant 2; Transgelin; WS3-10; WS3-10SM22-alpha TAGLN SM22, SM22-alpha, SMCC1, WS3-10, TAGLN transgelin transgelin|22 kDa actin-binding protein|epididymis secretory sperm binding protein|smooth muscle protein 22-alpha|transgelin variant 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TAGLN, check out the TAGLN Infographic

TAGLN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TAGLN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ01995

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SM22 alpha (TAGLN) (NM_003186) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ01995
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.