SLC25A16 (NM_152707) Human Recombinant Protein

GDC protein,

Recombinant protein of human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP16260
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SLC25A16 (NM_152707) Human Recombinant Protein

View all GDC recombinant proteins

SKU/Catalog Number

PROTP16260

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 (SLC25A16), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SLC25A16 (NM_152707) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP16260)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36 kDa

Amino Acid Sequence

MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN

Validation Images & Assay Conditions

Gene/Protein Information For SLC25A16 (Source: Uniprot.org, NCBI)

Gene Name

SLC25A16

Full Name

Graves disease carrier protein

Weight

36 kDa

Superfamily

mitochondrial carrier (TC 2.A.29) family

Alternative Names

D10S105EGDC; GDASolute carrier family 25 member 16; Graves disease autoantigen; graves disease carrier protein; HGT.1; hML7; member 16; MGC39851; Mitochondrial solute carrier protein homolog; ML7; solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen) SLC25A16 D10S105E, GDA, GDC, HGT.1, ML7, hML7 solute carrier family 25 member 16 graves disease carrier protein|mitochondrial solute carrier protein homolog|solute carrier family 25 (mitochondrial carrier; Graves disease auto), member 16

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SLC25A16, check out the SLC25A16 Infographic

SLC25A16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SLC25A16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP16260

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SLC25A16 (NM_152707) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SLC25A16 (NM_152707) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SLC25A16 (NM_152707) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP16260
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.