SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein

44166 protein,

Recombinant protein of human basic helix-loop-helix family, member e40 (BHLHE40)

Product Info Summary

SKU: PROTO14503
Size: 20 µg
Source: HEK293T

Product Name

SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein

View all 44166 recombinant proteins

SKU/Catalog Number

PROTO14503

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human basic helix-loop-helix family, member e40 (BHLHE40)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14503)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

45.3 kDa

Amino Acid Sequence

MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD

Validation Images & Assay Conditions

Gene/Protein Information For BHLHE40 (Source: Uniprot.org, NCBI)

Gene Name

BHLHE40

Full Name

Class E basic helix-loop-helix protein 40

Weight

45.3 kDa

Alternative Names

basic helix-loop-helix domain containing, class B, 2; basic helix-loop-helix family, member e40; bHLHb2; bHLHe40; Class B basic helix-loop-helix protein 2; class E basic helix-loop-helix protein 40; DEC1HLHB2; differentially expressed in chondrocytes 1; Differentially expressed in chondrocytes protein 1; differentiated embryo chondrocyte expressed gene 1; Enhancer-of-split and hairy-related protein 2; SHARP2; SHARP-2; Stimulated by retinoic acid gene 13 protein; STRA13FLJ99214; Stra14 BHLHE40 BHLHB2, Clast5, DEC1, HLHB2, SHARP-2, SHARP2, STRA13, Stra14 basic helix-loop-helix family member e40 class E basic helix-loop-helix protein 40|basic helix-loop-helix domain containing, class B, 2|class B basic helix-loop-helix protein 2|differentially expressed in chondrocytes 1|differentially expressed in chondrocytes protein 1|differentiated embryo chondrocyte expressed gene 1|enhancer-of-split and hairy-related protein 2|stimulated by retinoic acid gene 13 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BHLHE40, check out the BHLHE40 Infographic

BHLHE40 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BHLHE40: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14503

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14503
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.