SERF2 (NM_001018108) Human Recombinant Protein

SERF2 protein,

Product Info Summary

SKU: PROTP84101
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SERF2 (NM_001018108) Human Recombinant Protein

View all SERF2 recombinant proteins

SKU/Catalog Number

PROTP84101

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human small EDRK-rich factor 2 (SERF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SERF2 (NM_001018108) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP84101)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

6.7 kDa

Amino Acid Sequence

MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK

Validation Images & Assay Conditions

Gene/Protein Information For SERF2 (Source: Uniprot.org, NCBI)

Gene Name

SERF2

Full Name

Small EDRK-rich factor 2

Weight

6.7 kDa

Superfamily

SERF family

Alternative Names

4F5rel; FAM2CFLJ38557,4F5REL; FLJ20431; FLJ37527; Gastric cancer-related protein VRG107; H4F5REL; HsT17089; MGC48826; Protein 4F5-related; small EDRK-rich factor 2 SERF2 4F5REL, FAM2C, H4F5REL, HsT17089 small EDRK-rich factor 2 small EDRK-rich factor 2|gastric cancer-related protein VRG107|protein 4F5-related

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SERF2, check out the SERF2 Infographic

SERF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SERF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP84101

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SERF2 (NM_001018108) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SERF2 (NM_001018108) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SERF2 (NM_001018108) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP84101
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.