SDR O (SDR9C7) (NM_148897) Human Recombinant Protein

Sdr9c7 protein,

Recombinant protein of human short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7)

Product Info Summary

SKU: PROTQ8NEX9
Size: 20 µg
Source: HEK293T

Product Name

SDR O (SDR9C7) (NM_148897) Human Recombinant Protein

View all Sdr9c7 recombinant proteins

SKU/Catalog Number

PROTQ8NEX9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SDR O (SDR9C7) (NM_148897) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NEX9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.1 kDa

Amino Acid Sequence

MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEVTLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV

Validation Images & Assay Conditions

Gene/Protein Information For SDR9C7 (Source: Uniprot.org, NCBI)

Gene Name

SDR9C7

Full Name

Short-chain dehydrogenase/reductase family 9C member 7

Weight

35.1 kDa

Superfamily

short-chain dehydrogenases/reductases (SDR) family

Alternative Names

EC 1.1.1; EC 1.1.1.-; FLJ16333; MGC126600; Orphan short-chain dehydrogenase/reductase; RDH-S; RDHSMGC126602; SDR-Oorphan short-chain dehydrogenase / reductase; SDROretinol dehydrogenase similar protein; short chain dehydrogenase/reductase family 9C, member 7; short-chain dehydrogenase/reductase family 9C member 7

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SDR9C7, check out the SDR9C7 Infographic

SDR9C7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SDR9C7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NEX9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SDR O (SDR9C7) (NM_148897) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SDR O (SDR9C7) (NM_148897) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SDR O (SDR9C7) (NM_148897) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NEX9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.