SCAMP2 (NM_005697) Human Recombinant Protein

SCAMP2 protein,

Recombinant protein of human secretory carrier membrane protein 2 (SCAMP2)

Product Info Summary

SKU: PROTO15127
Size: 20 µg
Source: HEK293T

Product Name

SCAMP2 (NM_005697) Human Recombinant Protein

View all SCAMP2 recombinant proteins

SKU/Catalog Number

PROTO15127

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human secretory carrier membrane protein 2 (SCAMP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SCAMP2 (NM_005697) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15127)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

36.5 kDa

Amino Acid Sequence

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN

Validation Images & Assay Conditions

Gene/Protein Information For SCAMP2 (Source: Uniprot.org, NCBI)

Gene Name

SCAMP2

Full Name

Secretory carrier-associated membrane protein 2

Weight

36.5 kDa

Superfamily

SCAMP family

Alternative Names

secretory carrier membrane protein 2secretory carrier-associated membrane protein 2 SCAMP2 secretory carrier membrane protein 2 secretory carrier-associated membrane protein 2|testis secretory sperm-binding protein Li 219p

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SCAMP2, check out the SCAMP2 Infographic

SCAMP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SCAMP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15127

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SCAMP2 (NM_005697) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SCAMP2 (NM_005697) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SCAMP2 (NM_005697) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15127
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.