SCAMP1 (NM_004866) Human Recombinant Protein

SCAMP1 protein,

Recombinant protein of human secretory carrier membrane protein 1 (SCAMP1)

Product Info Summary

SKU: PROTO15126
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SCAMP1 (NM_004866) Human Recombinant Protein

View all SCAMP1 recombinant proteins

SKU/Catalog Number

PROTO15126

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human secretory carrier membrane protein 1 (SCAMP1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SCAMP1 (NM_004866) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15126)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37.7 kDa

Amino Acid Sequence

MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI

Validation Images & Assay Conditions

Gene/Protein Information For SCAMP1 (Source: Uniprot.org, NCBI)

Gene Name

SCAMP1

Full Name

Secretory carrier-associated membrane protein 1

Weight

37.7 kDa

Superfamily

SCAMP family

Alternative Names

secretory carrier membrane protein 1SCAMP37SCAMP; secretory carrier-associated membrane protein 1 SCAMP1 SCAMP, SCAMP37 secretory carrier membrane protein 1 secretory carrier-associated membrane protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SCAMP1, check out the SCAMP1 Infographic

SCAMP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SCAMP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15126

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SCAMP1 (NM_004866) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SCAMP1 (NM_004866) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SCAMP1 (NM_004866) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15126
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.