S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein

S100A2 protein,

Product Info Summary

SKU: PROTP29034
Size: 20 µg
Source: HEK293T

Product Name

S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein

View all S100A2 recombinant proteins

SKU/Catalog Number

PROTP29034

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A2 (S100A2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP29034)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.8 kDa

Amino Acid Sequence

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP

Validation Images & Assay Conditions

Gene/Protein Information For S100A2 (Source: Uniprot.org, NCBI)

Gene Name

S100A2

Full Name

Protein S100-A2

Weight

10.8 kDa

Superfamily

S-100 family

Alternative Names

CAN19; CAN19protein S100-A2; MGC111539; S100 calcium binding protein A2; S100 calcium-binding protein A2Protein S-100L; S100A2; S100L S100A2 CAN19, S100L S100 calcium binding protein A2 protein S100-A2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A2, check out the S100A2 Infographic

S100A2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP29034

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for S100 alpha 2 (S100A2) (NM_005978) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP29034
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.