RIT1 (NM_006912) Human Recombinant Protein

RIT1 protein,

Recombinant protein of human Ras-like without CAAX 1 (RIT1)

Product Info Summary

SKU: PROTQ92963
Size: 20 µg
Source: HEK293T

Product Name

RIT1 (NM_006912) Human Recombinant Protein

View all RIT1 recombinant proteins

SKU/Catalog Number

PROTQ92963

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Ras-like without CAAX 1 (RIT1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RIT1 (NM_006912) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92963)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25 kDa

Amino Acid Sequence

MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

Validation Images & Assay Conditions

Gene/Protein Information For RIT1 (Source: Uniprot.org, NCBI)

Gene Name

RIT1

Full Name

GTP-binding protein Rit1

Weight

25 kDa

Superfamily

small GTPase superfamily

Alternative Names

GTP-binding protein Rit1; GTP-binding protein Roc1; MGC125864; MGC125865; Ras-like protein expressed in many tissues; Ras-like without CAAX 1; Ras-like without CAAX protein 1; RIBB; RIBBRIT; Ric-like, expressed in many tissues; RIT; Rit1; ROC1; ROC1Ric (Drosophila)-like, expressed in many tissues RIT1 NS8, RIBB, RIT, ROC1 Ras like without CAAX 1 GTP-binding protein Rit1|GTP-binding protein Roc1|Ric-like, expressed in many tissues|ras-like protein expressed in many tissues|ras-like without CAAX protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RIT1, check out the RIT1 Infographic

RIT1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RIT1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92963

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RIT1 (NM_006912) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RIT1 (NM_006912) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RIT1 (NM_006912) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92963
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product