RHOF (NM_019034) Human Recombinant Protein

Rhof protein,

Purified recombinant protein of Homo sapiens ras homolog gene family, member F (in filopodia) (RHOF)

Product Info Summary

SKU: PROTQ9HBH0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RHOF (NM_019034) Human Recombinant Protein

View all Rhof recombinant proteins

SKU/Catalog Number

PROTQ9HBH0

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens ras homolog gene family, member F (in filopodia) (RHOF)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RHOF (NM_019034) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9HBH0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.4 kDa

Amino Acid Sequence

MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLLL

Validation Images & Assay Conditions

Gene/Protein Information For Rhof (Source: Uniprot.org, NCBI)

Gene Name

Rhof

Full Name

Rho-related GTP-binding protein RhoF

Weight

23.4 kDa

Superfamily

small GTPase superfamily

Alternative Names

FLJ20247; ras homolog gene family, member F (in filopodia); Rho family GTPase Rif; Rho in filopodia; rho-related GTP-binding protein RhoF; RIFARHF Rhof|AI845056, AV026554, Ar, Arhf, Ifl, Ifld1, Rif|ras homolog family member F (in filopodia)|rho-related GTP-binding protein RhoF|induced in fatty liver dystrophy 1|ras homolog gene family, member f (in filopodia)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Rhof, check out the Rhof Infographic

Rhof infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Rhof: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9HBH0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RHOF (NM_019034) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RHOF (NM_019034) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RHOF (NM_019034) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9HBH0
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.