RGS20 (NM_003702) Human Recombinant Protein

RGS20 protein,

Recombinant protein of human regulator of G-protein signaling 20 (RGS20), transcript variant 2

Product Info Summary

SKU: PROTO76081
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RGS20 (NM_003702) Human Recombinant Protein

View all RGS20 recombinant proteins

SKU/Catalog Number

PROTO76081

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human regulator of G-protein signaling 20 (RGS20), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RGS20 (NM_003702) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO76081)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.9 kDa

Amino Acid Sequence

MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA

Validation Images & Assay Conditions

Gene/Protein Information For RGS20 (Source: Uniprot.org, NCBI)

Gene Name

RGS20

Full Name

Regulator of G-protein signaling 20

Weight

26.9 kDa

Alternative Names

G(z)GAP; Gz-GAP; Gz-selective GTPase-activating protein; regulator of G-protein signaling 20; Regulator of G-protein signaling Z1; regulator of G-protein signalling 20; Regulator of Gz-selective protein signaling 1; RGSZ1g(z)GAP; ZGAP1gz-GAP RGS20 RGSZ1, ZGAP1, g(z)GAP, gz-GAP regulator of G protein signaling 20 regulator of G-protein signaling 20|gz-selective GTPase-activating protein|regulator of G-protein signaling 20 variant 2|regulator of G-protein signaling Z1|regulator of G-protein signalling 20|regulator of Gz-selective protein signaling 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RGS20, check out the RGS20 Infographic

RGS20 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RGS20: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO76081

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RGS20 (NM_003702) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RGS20 (NM_003702) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RGS20 (NM_003702) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO76081
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.