REM2 (NM_173527) Human Recombinant Protein

Rem2 protein,

Recombinant protein of human RAS (RAD and GEM)-like GTP binding 2 (REM2)

Product Info Summary

SKU: PROTQ8IYK8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

REM2 (NM_173527) Human Recombinant Protein

View all Rem2 recombinant proteins

SKU/Catalog Number

PROTQ8IYK8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAS (RAD and GEM)-like GTP binding 2 (REM2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

REM2 (NM_173527) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IYK8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

37 kDa

Amino Acid Sequence

MDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLVGESGVGKSTLAGTFGGLQGDSAHEPENPEDTYERRIMVDKEEVTLVVYDIWEQGDAGGWLRDHCLQTGDAFLIVFSVTDRRSFSKVPETLLRLRAGRPHHDLPVILVGNKSDLARSREVSLEEGRHLAGTLSCKHIETSAALHHNTRELFEGAVRQIRLRRGRNHAGGQRPDPGSPEGPAPPARRESLTKKAKRFLANLVPRNAKFFKQRSRSCHDLSVL

Validation Images & Assay Conditions

Gene/Protein Information For REM2 (Source: Uniprot.org, NCBI)

Gene Name

REM2

Full Name

GTP-binding protein REM 2

Weight

37 kDa

Superfamily

small GTPase superfamily

Alternative Names

CD300LE; FLJ38964; GTP-binding protein REM 2; ICLM2; Rad and Gem-like GTP-binding protein 2; Rad and Gem-related 2 (rat homolog); RAS (RAD and GEM) like GTP binding 2; RAS (RAD and GEM)-like GTP binding 2 Rem2|RRAD and GEM like GTPase 2|GTP-binding protein REM 2|GEM, REM, Kir family small G-protein|GTP-binding protein REM2|RAS (RAD and GEM) like GTP binding 2|Ras-related GTP-binding protein of the Rad/Gem/Kir family, member 2|rad and Gem-like GTP-binding protein 2|rad and gem related GTP binding protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on REM2, check out the REM2 Infographic

REM2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for REM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IYK8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used REM2 (NM_173527) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For REM2 (NM_173527) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for REM2 (NM_173527) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IYK8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.